Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,396 – 1,410 of 1,599,993 results

1,396

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgM κ
Gene Accession No.	P25445
Concentration	1 mg/mL
Antigen	CD95 (APO-1/Fas)
Gene Symbols	FAS
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI196731; ALPS1A; APO1; APO-1; Apo1 antigen; Apo-1 antigen; APO-1 cell surface antigen; Apo-1 Fas; apoptosis antigen 1; apoptosis signaling receptor FAS; apoptosis-mediating surface antigen FAS; APT1; CD95; CD95 antigen; FAS; Fas (TNF receptor superfamily member 6); Fas (TNF receptor superfamily member); Fas (TNF receptor superfamily, member 6); Fas AMA; Fas antigen; Fas antigen (ATP1); Fas cell surface death receptor; Fas receptor; FAS1; FASLG receptor; FASTM; lpr; lymphoproliferation; OTTHUMP00000020045; OTTHUMP00000020046; OTTHUMP00000020051; OTTHUMP00000059646; TNF receptor superfamily member 6; TNFR6; Tnfrsf6; tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily member 26; Tumor necrosis factor receptor superfamily, member 6
Gene	FAS
Product Type	Antibody
Gene ID (Entrez)	355
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	EOS9.1

1,397

Invitrogen™ NTCP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O08705, P26435
Isotype	IgG
Concentration	500 μg/mL
Antigen	NTCP
Gene Symbols	SLC10A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1
Gene	SLC10A1
Product Type	Antibody
Gene ID (Entrez)	20493, 24777
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
Classification	Polyclonal
Primary or Secondary	Primary

1,398

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	DyLight 488
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	P22083, Q11127
Isotype	IgM
Concentration	1 mg/mL
Antigen	SSEA1
Gene Symbols	FUT4
Regulatory Status	RUO
Purification Method	Affinity chromatography - MBP
Gene Alias	FUTIV; Lewis X; SSEA-1
Gene	FUT4
Product Type	Antibody
Gene ID (Entrez)	14345, 2526
Formulation	PBS with proprietary stabilizer and 0.02% sodium azide
Immunogen	BALB/c mouse immunized with F9 teratocarcinoma stem cells (X-irradiated).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MC-480

1,399

Invitrogen™ CNR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P34972, Q9QZN9
Isotype	IgG
Concentration	1 mg/mL
Antigen	CNR2
Gene Symbols	CNR2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Cannabinoid Receptor 2; cannabinoid receptor 2 (macrophage); CB2; CB-2; CB2 receptor; CB2A; CB2B; CB2C; CB2R; CB2-R; CNR2; CNR2C; CNR3; CX5; HCB2; HGNC:2160; OTTHUMP00000044841; peripheral cannabinoid receptor; rCB2; RP11-4M23.1; testis-dominant CNR2 isoform CB2
Gene	CNR2
Product Type	Antibody
Gene ID (Entrez)	1269, 57302
Formulation	PBS with 1mg/mL BSA, 50% glycerol and 0.05% sodium azide
Immunogen	GST fusion protein containing the first 32 amino acid residues from Rat CB2.
Classification	Polyclonal
Primary or Secondary	Primary

1,400

Invitrogen™ CD4 Monoclonal Antibody (S3.5), Qdot™ 655

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Qdot 655
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01730
Isotype	IgG2a
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	920
Formulation	0.05M borate with 1M betaine and 0.05% sodium azide; pH 8.3
Immunogen	Human CD4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	S3.5

1,401

Invitrogen™ CD369 (Clec7a, Dectin-1) Monoclonal Antibody (bg1fpj), PE, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q6QLQ4
Isotype	IgG2a κ
Concentration	0.2 mg/mL
Antigen	CD369 (Clec7a, Dectin-1)
Gene Symbols	Clec7a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Beta-glucan receptor; beta-GR; BGR; CANDF4; CD369; CLEC7A; Clec7b; CLECSF12; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; C-type lectin domain family 7 member A; C-type lectin domain family 7, member A; C-type lectin superfamily member 12; DC-associated C-type lectin 1; DECTIN1; dectin-1; Dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; lectin-like receptor 1; RGD1565140; SCARE2; UNQ539/PRO1082
Gene	Clec7a
Product Type	Antibody
Gene ID (Entrez)	56644
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	Baculovirus-expressed Fc-containing protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	bg1fpj

1,402

Invitrogen™ CD45.2 Monoclonal Antibody (104), PE-Cyanine7

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P06800
Isotype	IgG2a κ
Concentration	0.1 mg/mL
Antigen	CD45.2
Gene Symbols	Ptprc
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	B220; Cd45; CD45 antigen; CD45R; GP180; LCA; L-CA; leukocyte common antigen; loc; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; protein tyrosine phosphatase, receptor type, C; Ptprc; Receptor-type tyrosine-protein phosphatase C; T200; T200 glycoprotein
Gene	Ptprc
Product Type	Antibody
Gene ID (Entrez)	19264
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.1
Immunogen	B10.S mouse thymocytes and splenocytes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	104

1,403

CD163 Monoclonal Antibody (TNKUPJ), Brilliant Violet™ 421, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Violet 421
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q2VLH6
Concentration	0.2 mg/mL
Antigen	CD163
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD163; CD163 antigen; CD163 molecule; CD163v2; CD163v3; Hemoglobin scavenger receptor; M130; macrophage-associated antigen; MM130; putative CD163 antigen; SCARI1; Scavenger receptor cysteine-rich type 1 protein M130; sCD163; Soluble CD163; Soluble sCD163
Gene	CD163
Product Type	Antibody
Gene ID (Entrez)	93671
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TNKUPJ

1,404

Invitrogen™ Follicle Stimulating Hormone Monoclonal Antibody (P2B4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunoprecipitation,Radioimmune Assays (RIA),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01215, P01216, P01225, Q60687
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Follicle Stimulating Hormone
Gene Symbols	CGA, FSHB
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	class 1 follicle-stimulating hormone beta polypeptide; class 2 follicle-stimulating hormone beta polypeptide; follicle - stimulating hormone subunit beta; follicle stimulating hormone beta; follicle stimulating hormone beta subunit; follicle stimulating hormone beta-subunit precursor; follicle stimulating hormone subunit beta; follicle stimulating hormone, beta polypeptide; follicle-stimulating hormone beta subunit; follicle-stimulating hormone beta-subunit; follicle-stimulating hormone subunit beta; follicule stimulating hormone, beta polypeptide; follitropin beta chain; Follitropin subunit beta; follitropin, beta chain; FSH; FSH-alpha; FSHB; FSH-B; Fshbeta; FSH-beta; HH24; LSH-alpha; prefollicle stimulating hormone beta chain; TSH-alpha
Gene	FSHB
Product Type	Antibody
Gene ID (Entrez)	1081, 12640, 14308, 2488
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Human Follicle Stimulating Hormone.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	P2B4

1,405

CD154 (CD40 Ligand) Monoclonal Antibody (24-31), eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Cynomolgus Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P29965
Concentration	0.5 mg/mL
Antigen	CD154 (CD40 Ligand)
Gene Symbols	CD40LG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	CD40LG
Product Type	Antibody
Gene ID (Entrez)	102138630, 959
Classification	Monoclonal
Primary or Secondary	Primary
Clone	24-31

1,406

CD127 Monoclonal Antibody (eBioRDR5), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P16871
Antigen	CD127
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	3575
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioRDR5

1,407

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), APC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P16297
Concentration	0.2 mg/mL
Antigen	CD122
Gene Symbols	Il2rb
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD122; CD122 antigen; high affinity IL-2 receptor beta subunit; high affinity IL-2 receptor subunit beta; IL-15 receptor beta chain; IL15RB; IL15Rbeta; IL-15Rbeta; IL-2 receptor beta chain; IL-2 receptor subunit beta; IL-2/15 receptor-beta; Il-2/15Rbeta; IL-2R subunit beta; IL2RB; IL-2RB; IL2RBC; Il-2Rbeta; interleukin 15 receptor, beta; interleukin 2 receptor subunit beta; interleukin 2 receptor, beta; interleukin 2 receptor, beta chain; Interleukin-15 receptor subunit beta; Interleukin-2 receptor subunit beta; p70; p70-75; p75
Gene	Il2rb
Product Type	Antibody
Gene ID (Entrez)	16185
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TM-b1 (TM-beta1)

1,408

Invitrogen™ CTLA-4 Monoclonal Antibody (1B8), FITC

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	FITC
Applications	ELISA,Flow Cytometry
Form	Liquid
Gene Accession No.	P09793
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	CTLA-4
Gene Symbols	CTLA4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	ALPS5; CD; CD152; CD152 antigen; CD152 isoform; CD152 protein; CD152 protein precursor; celiac disease 3; CELIAC3; Ctla4; CTLA-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte associated protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte-associated serine esterase-4; EGK_04712; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Ly-56; sCTLA4; soluble form; transmembrane form
Gene	CTLA4
Product Type	Antibody
Gene ID (Entrez)	12477
Formulation	PBS with <0.1% sodium azide; pH 7.4
Immunogen	Mouse CD152 (CTLA-4). from Extracellular portion of murine CTLA-4 fused to a murine IgG2a.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1B8

1,409

Invitrogen™ TGFBR2 Recombinant Rabbit Monoclonal Antibody (16H2L4)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P37173
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	TGFBR2
Gene Symbols	TGFBR2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene	TGFBR2
Product Type	Antibody
Gene ID (Entrez)	7048
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to Human TGFBR2 (aa 73-495).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	16H2L4

1,410

Invitrogen™ beta Tubulin 2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Drosophila,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P61857, P85108, Q13885, Q3KRE8, Q7TMM9, Q9BVA1, Q9CWF2
Isotype	IgG
Concentration	1 mg/mL
Antigen	beta Tubulin 2
Gene Symbols	betaTub85D, TUBB2A, TUBB2B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2410129E14Rik; 2t; b2 tubulin; B2t; bA506K6.1; beta 2 tubulin; BETA 85D; beta tubulin; beta(2)Tu; beta(2)Tub; beta(2)Tubulin; beta;Tub85D; beta[[2]]-tubulin; BETA2; beta2 tubulin; beta2t; beta2tub; beta2-tub; beta2tubulin; Beta-2-tubulin; beta2-tubulin; beta85D; betaTub; beta-tub; betaTub2; BetaTub85D; beta-tub85D; betaTub85D-PA; beta-Tubulin; beta-Tubulin 85D; beta-Tubulin at 85D; beta-tubulin T beta15 (aa 1-445); betaTubulin85D; beta-tubulin85D; brdp; CDCBM5; CG9359; CG9359-PA; class II beta-tubulin isotype; class IIa beta-tubulin; class IIb beta-tubulin; D.m.BETA-85D; dJ40E16.7; Dmbeta2; Dmel\CG9359; Dmel_CG9359; DTB4; GH02051p; M(beta)2; ms(3)KK[D]; PMGYSA; RGD1309427; t beta-15; testis-specific beta-tubulin; Tub; Tub2A; TUBB; TUBB2; TUBB2A; tubb2a {ECO:0000250; Tubb2b; TubB85D; tubulin; tubulin beta; tubulin beta 2A class IIa; tubulin beta 2B class IIb; Tubulin beta class IIa; Tubulin beta-2 chain; Tubulin beta-2A chain; tubulin beta-2B chain; tubulin, beta 2; tubulin, beta 2A class IIa; tubulin, beta 2B class IIb; tubulin, beta polypeptide; tubulin, beta polypeptide 2; tubulin, beta polypeptide paralog; UniProtKB:Q7TMM9}
Gene	TUBB2A
Product Type	Antibody
Gene ID (Entrez)	22151, 291081, 347733, 41124, 498736, 7280, 73710
Formulation	PBS with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human beta Tubulin 2. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
92
93
94
95
...
106,667
Next

Primary Antibodies

Filtered Search Results

Narrow Results

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NTCP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CNR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (S3.5), Qdot™ 655 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD369 (Clec7a, Dectin-1) Monoclonal Antibody (bg1fpj), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD45.2 Monoclonal Antibody (104), PE-Cyanine7 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD163 Monoclonal Antibody (TNKUPJ), Brilliant Violet™ 421, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Follicle Stimulating Hormone Monoclonal Antibody (P2B4) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD154 (CD40 Ligand) Monoclonal Antibody (24-31), eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD127 Monoclonal Antibody (eBioRDR5), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CTLA-4 Monoclonal Antibody (1B8), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ beta Tubulin 2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ NTCP Polyclonal Antibody

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488

Invitrogen™ CNR2 Polyclonal Antibody

Invitrogen™ CD4 Monoclonal Antibody (S3.5), Qdot™ 655

Invitrogen™ CD369 (Clec7a, Dectin-1) Monoclonal Antibody (bg1fpj), PE, eBioscience™

Invitrogen™ CD45.2 Monoclonal Antibody (104), PE-Cyanine7

CD163 Monoclonal Antibody (TNKUPJ), Brilliant Violet™ 421, eBioscience™, Invitrogen™

Invitrogen™ Follicle Stimulating Hormone Monoclonal Antibody (P2B4)

CD154 (CD40 Ligand) Monoclonal Antibody (24-31), eBioscience™, Invitrogen™

CD127 Monoclonal Antibody (eBioRDR5), Alexa Fluor™ 488, eBioscience™, Invitrogen™

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), APC, eBioscience™, Invitrogen™

Invitrogen™ CTLA-4 Monoclonal Antibody (1B8), FITC

Invitrogen™ beta Tubulin 2 Polyclonal Antibody